PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00053584-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 322aa    MW: 35973.5 Da    PI: 5.0035
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00053584-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.7e-162467146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      rg++T+eE+  ++++++ lG++ W++Ia+ ++ gRt++++k++w +
  PSME_00053584-RA 24 RGSFTQEEERTIIQLHAILGNR-WSAIASQLP-GRTDNEIKNFWST 67
                      89********************.*********.***********65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.391118IPR017877Myb-like domain
SuperFamilySSF466891.33E-21578IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-11531IPR009057Homeodomain-like
PROSITE profilePS5129425.4591973IPR017930Myb domain
SMARTSM007175.8E-162371IPR001005SANT/Myb domain
PfamPF002497.5E-152467IPR001005SANT/Myb domain
CDDcd001677.38E-112665No hitNo description
Gene3DG3DSA:1.10.10.601.7E-213270IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGLLRCGKSC RLRWTNYLRP DIKRGSFTQE EERTIIQLHA ILGNRWSAIA SQLPGRTDNE  60
IKNFWSTRLK KRLLKMGLDP STHAPIAEAN GTAPEGSDAM ALTRHKAQWE NARLEAEARL  120
SRASLLMSSN SKAGYHTNNG TAETTAMPSD NPPADYFLKM WNSEAGKAFR KENQYHPNEG  180
RGDPHAALSS EIPPSSLSSL CCASTQNSGG ESLKPNDKDN DINGFHQCNS TSFEWNGDCN  240
VDTAEEFSCF ADMNMGQTHE DKAAEELGFP ELLLDFSDND GNVNQSNSVQ SELSAGFQQP  300
PAWSWPELHD EDYWNNMWSE HR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2157340108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGVIT_15s0046g03190.t015e-64(Vitis vinifera)
STRINGGLYMA09G39721.17e-64(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.18e-54myb domain protein 17